PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016488300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 867aa    MW: 98370.9 Da    PI: 9.7223
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016488300.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.11.2e-11381171398
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      +rl++p +fa+++ ++  ++  + le +sg++Wev++    ++gr+ l+ GW++F +   +  g f++F ++ rs f  +v++f+
  XP_016488300.1  38 CSRLRIPEDFASKYCKNMLNP--VYLEVPSGEVWEVEV--VHSQGRICLGIGWQDFSDFYSISCGHFLIFGYNARSHF--NVTIFD 117
                     468***********5454444..***************..999999**************************999999..999987 PP

2B3438.3e-14263345492
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                      + ps+v++  +l++p kfa+++ +++ +   l+l  +   sW+vk+++  +  +++    Wk Fv +n+Lk gD++vF++++ ++  +
  XP_016488300.1 263 FMQPSYVFSPFNLSMPLKFARKYFLENYG--NLVLHVPGRGSWSVKCTFGTTNAKIF----WKAFVMDNKLKPGDVCVFEVIKGTKLLM 345
                     6889*******************877655..6***************8866655554....*******************887555444 PP

3B348.71.4e-15508595697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ps+v+k  +l ++ +fa+++  ++ +    +l+ +   sW+v++ + ++s+   +++GWk Fv++n+Lk gD++vF++++ ++  + v++f
  XP_016488300.1 508 QPSYVSKPYNLNISATFAKKYFRDEYS--NFVLRVPGRGSWSVEC-FLGTSK-AQIRSGWKAFVQDNKLKYGDVCVFEVIKVTKLLMDVTIF 595
                     6899*****************777555..69**************.444443.459**********************99877776666666 PP

4B341.72e-13760850599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     + ps+vl+  rl ++  fa+++  +k ++  l+l+ +   sW+vk+i  k++ ++ +   Wk Fv +n+Lk gD++vF+l++ ++  l v++fr+
  XP_016488300.1 760 MQPSYVLTPYRLDISFLFARKYVWEK-CG-FLVLRVPGRGSWSVKYILGKSKTKICFY--WKAFVLDNKLKFGDVCVFELIKGTKPILDVTIFRT 850
                     6799******************5443.43.6999******************999999..*********************88777788888885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-1722119IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-1725119IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.03926119IPR003340B3 DNA binding domain
CDDcd100173.65E-1126117No hitNo description
SMARTSM010191.2E-829119IPR003340B3 DNA binding domain
PfamPF023622.5E-839117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-16253347IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-16255350IPR015300DNA-binding pseudobarrel domain
CDDcd100178.74E-17258351No hitNo description
SMARTSM010192.0E-10260353IPR003340B3 DNA binding domain
PROSITE profilePS508639.756260353IPR003340B3 DNA binding domain
PfamPF023622.3E-11262343IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-21495596IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.46E-19496595IPR015300DNA-binding pseudobarrel domain
CDDcd100178.99E-15501596No hitNo description
SMARTSM010191.0E-11502598IPR003340B3 DNA binding domain
PROSITE profilePS5086312.055503598IPR003340B3 DNA binding domain
PfamPF023622.0E-12507595IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-17748849IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-18749849IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.588756851IPR003340B3 DNA binding domain
SMARTSM010193.5E-9759851IPR003340B3 DNA binding domain
PfamPF023621.8E-10760849IPR003340B3 DNA binding domain
CDDcd100174.35E-15760849No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 867 aa     Download sequence    Send to blast
MAAKPHLQSG EGSSHWKSST AKIPQPKFFK IIFFQHECSR LRIPEDFASK YCKNMLNPVY  60
LEVPSGEVWE VEVVHSQGRI CLGIGWQDFS DFYSISCGHF LIFGYNARSH FNVTIFDLSA  120
SEIEYPYSSA HGIHTPISYS HETRHAQERD QSESDHSVEI HEVIPRSQKA NTITPDMVEN  180
SVENLDHCPL GQSSKRQRQG DAEDVASPSF IRKGQKSSEG CCTHMQQSKI VYDENKTVMD  240
KERAIAYRRA KGFKSKNPFI ISFMQPSYVF SPFNLSMPLK FARKYFLENY GNLVLHVPGR  300
GSWSVKCTFG TTNAKIFWKA FVMDNKLKPG DVCVFEVIKG TKLLMDITIF PAAGEVPGVS  360
DSSVPLSQSR IAQTKNLKQR RGGACGFNSK VKAEEHGEGT GNEHSFEILG HCPLVQYRKR  420
KRLERDAEDD VPIDIHTKNI KVETSHKDVT LPSFRKIKKS GESCRMHKQQ TMIVCGKNKA  480
GMNKERAMAY QRAKAFKSKN PFIISFIQPS YVSKPYNLNI SATFAKKYFR DEYSNFVLRV  540
PGRGSWSVEC FLGTSKAQIR SGWKAFVQDN KLKYGDVCVF EVIKVTKLLM DVTIFPAAGS  600
TPILKIAGEV PGVSDSKRKI INTDIYVPCS PPKVVHTNRL KQRRGEEHDE GTGIESSAEI  660
LGHCPLGHDR KIKRLEEETE DDVSIDIHTK SIKVANTQED VASPSFTRKT KKSGESCQMD  720
KQQSKMVYDK NTTVLDKERT VAYQRAKAFK SENPYVMYFM QPSYVLTPYR LDISFLFARK  780
YVWEKCGFLV LRVPGRGSWS VKYILGKSKT KICFYWKAFV LDNKLKFGDV CVFELIKGTK  840
PILDVTIFRT AESKPIHKID GKLPGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1423685223144B3 domain-containing transcription factor VRN
4i1k_B4e-1423685223144B3 domain-containing transcription factor VRN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016488300.10.0PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-34B3 family protein